| Class g: Small proteins [56992] (90 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (22 proteins) |
| Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
| Species Sheep (Ovis aries) [TaxId:9940] [57211] (20 PDB entries) Uniprot P05979 32-584 |
| Domain d1ptha2: 1pth A:33-73 [44248] Other proteins in same PDB: d1ptha1, d1pthb1 complexed with bog, brm, hem, nag, sal |
PDB Entry: 1pth (more details), 3.4 Å
SCOP Domain Sequences for d1ptha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ptha2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe
Timeline for d1ptha2: