SCOP 1.55: Domain d1pth_2: 1pth 33-73

Lineage for d1pth_2 (1pth 33-73)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (4 families)

5. Family g.3.11.1: EGF-type module [57197] (16 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [57211] (8 PDB entries)

8. Domain d1pth_2: 1pth 33-73 [44248]
   Other proteins in same PDB: d1pth_1

Details for d1pth_2

PDB Entry: 1pth, 3.4 Å

PDB Description: the structural basis of aspirin activity inferred from the crystal structure of inactivated prostaglandin h2 synthase

SCOP Domain Sequences for d1pth_2:

Sequence; same for both SEQRES and ATOM records:

>d1pth_2 g.3.11.1 (33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries)}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d1pth_2:

• d1pth_2 appears in SCOP 1.57
  
• d1pth_2 appears in the current release, SCOPe 2.08, called d1ptha2