Lineage for d1cqea2 (1cqe A:32-73)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 40056Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
  7. 40082Species Sheep (Ovis aries) [TaxId:9940] [57211] (8 PDB entries)
  8. 40083Domain d1cqea2: 1cqe A:32-73 [44246]
    Other proteins in same PDB: d1cqea1, d1cqeb1

Details for d1cqea2

PDB Entry: 1cqe (more details), 3.1 Å

PDB Description: prostaglandin h2 synthase-1 complex with flurbiprofen

SCOP Domain Sequences for d1cqea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqea2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries)}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOP Domain Coordinates for d1cqea2:

Click to download the PDB-style file with coordinates for d1cqea2.
(The format of our PDB-style files is described here.)

Timeline for d1cqea2:

40083
d1cqea2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1cqea1