Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Activated protein c (autoprothrombin IIa) [57208] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57209] (1 PDB entry) |
Domain d1autl2: 1aut L:97-146 [44245] Other proteins in same PDB: d1autc_ complexed with mai |
PDB Entry: 1aut (more details), 2.8 Å
SCOP Domain Sequences for d1autl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} ncsldnggcthycleevgwrrcscapgyklgddllqchpavkfpcgrpwk
Timeline for d1autl2: