Lineage for d1whfa1 (1whf A:47-86)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636123Protein Factor X, N-terminal module [57205] (2 species)
  7. 2636124Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries)
  8. 2636129Domain d1whfa1: 1whf A:47-86 [44243]
    Other proteins in same PDB: d1whfa2

Details for d1whfa1

PDB Entry: 1whf (more details)

PDB Description: coagulation factor, nmr, 15 structures
PDB Compounds: (A:) coagulation factor x

SCOPe Domain Sequences for d1whfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whfa1 g.3.11.1 (A:47-86) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}
gdqceghpclnqghckdgigdytctcaegfegkncefstr

SCOPe Domain Coordinates for d1whfa1:

Click to download the PDB-style file with coordinates for d1whfa1.
(The format of our PDB-style files is described here.)

Timeline for d1whfa1:

2636129
d1whfa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1whfa2