Lineage for d1whf_1 (1whf 47-86)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 88835Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 88883Protein Factor X, N-terminal module [57205] (2 species)
  7. 88884Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries)
  8. 88889Domain d1whf_1: 1whf 47-86 [44243]
    Other proteins in same PDB: d1whf_2

Details for d1whf_1

PDB Entry: 1whf (more details)

PDB Description: coagulation factor, nmr, 15 structures

SCOP Domain Sequences for d1whf_1:

Sequence, based on SEQRES records: (download)

>d1whf_1 g.3.11.1 (47-86) Factor X, N-terminal module {Cow (Bos taurus)}
gdqceghpclnqghckxgigdytctcaegfegkncefstr

Sequence, based on observed residues (ATOM records): (download)

>d1whf_1 g.3.11.1 (47-86) Factor X, N-terminal module {Cow (Bos taurus)}
gdqceghpclnqghckgigdytctcaegfegkncefstr

SCOP Domain Coordinates for d1whf_1:

Click to download the PDB-style file with coordinates for d1whf_1.
(The format of our PDB-style files is described here.)

Timeline for d1whf_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1whf_2