SCOPe 2.05: Domain d1ccfa_: 1ccf A:

Lineage for d1ccfa_ (1ccf A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Factor X, N-terminal module [57205] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries)

8. Domain d1ccfa_: 1ccf A: [44241]

Details for d1ccfa_

PDB Entry: 1ccf

PDB Description: how an epidermal growth factor (egf)-like domain binds calcium-high resolution nmr structure of the calcium form of the nh2-terminal egf- like domain in coagulation factor x

PDB Compounds: (A:) coagulation factor x

SCOPe Domain Sequences for d1ccfa_:

Sequence; same for both SEQRES and ATOM records:

>d1ccfa_ g.3.11.1 (A:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}
kdgdqceghpclnqghckdgigdytctcaegfegkncefstr

Timeline for d1ccfa_:

• d1ccfa_ first appeared (with stable ids) in SCOP 1.55, called d1ccf__
  
• d1ccfa_ appears in SCOPe 2.04
  
• d1ccfa_ appears in SCOPe 2.06
  
• d1ccfa_ appears in the current release, SCOPe 2.08