Lineage for d1xkal1 (1xka L:49-86)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 40011Protein Factor X, N-terminal module [57205] (2 species)
  7. 40018Species Human (Homo sapiens) [TaxId:9606] [57206] (9 PDB entries)
  8. 40029Domain d1xkal1: 1xka L:49-86 [44236]
    Other proteins in same PDB: d1xkac_

Details for d1xkal1

PDB Entry: 1xka (more details), 2.3 Å

PDB Description: factor xa complexed with a synthetic inhibitor fx-2212a,(2s)-(3'-amidino-3-biphenylyl)-5-(4-pyridylamino)pentanoic acid

SCOP Domain Sequences for d1xkal1:

Sequence, based on SEQRES records: (download)

>d1xkal1 g.3.11.1 (L:49-86) Factor X, N-terminal module {Human (Homo sapiens)}
qcetspcqnqgkckxglgeytctclegfegkncelftr

Sequence, based on observed residues (ATOM records): (download)

>d1xkal1 g.3.11.1 (L:49-86) Factor X, N-terminal module {Human (Homo sapiens)}
qcetspcqnqgkckglgeytctclegfegkncelftr

SCOP Domain Coordinates for d1xkal1:

Click to download the PDB-style file with coordinates for d1xkal1.
(The format of our PDB-style files is described here.)

Timeline for d1xkal1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xkal2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xkac_