Lineage for d1xkba1 (1xkb A:48-86)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 40011Protein Factor X, N-terminal module [57205] (2 species)
  7. 40018Species Human (Homo sapiens) [TaxId:9606] [57206] (9 PDB entries)
  8. 40025Domain d1xkba1: 1xkb A:48-86 [44232]
    Other proteins in same PDB: d1xkbc_, d1xkbd_

Details for d1xkba1

PDB Entry: 1xkb (more details), 2.4 Å

PDB Description: factor xa complexed with a synthetic inhibitor fx-2212a,(2s)-(3'-amidino-3-biphenylyl)-5-(4-pyridylamino)pentanoic acid

SCOP Domain Sequences for d1xkba1:

Sequence, based on SEQRES records: (download)

>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens)}
dqcetspcqnqgkckxglgeytctclegfegkncelftr

Sequence, based on observed residues (ATOM records): (download)

>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens)}
dqcetspcqnqgkckglgeytctclegfegkncelftr

SCOP Domain Coordinates for d1xkba1:

Click to download the PDB-style file with coordinates for d1xkba1.
(The format of our PDB-style files is described here.)

Timeline for d1xkba1: