Lineage for d1bf9__ (1bf9 -)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268805Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 269314Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 269315Family g.3.11.1: EGF-type module [57197] (18 proteins)
  6. 269324Protein Coagulation factor VIIa [57201] (1 species)
  7. 269325Species Human (Homo sapiens) [TaxId:9606] [57202] (13 PDB entries)
  8. 269343Domain d1bf9__: 1bf9 - [44223]
    N-terminal domain

Details for d1bf9__

PDB Entry: 1bf9 (more details)

PDB Description: n-terminal egf-like domain from human factor vii, nmr, 23 structures
PDB Compounds: ( :)

SCOP Domain Sequences for d1bf9__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf9__ g.3.11.1 (-) Coagulation factor VIIa {Human (Homo sapiens)}
sdgdqcasspcqnggsckdqlqsyicfclpafegrncethk

SCOP Domain Coordinates for d1bf9__:

Click to download the PDB-style file with coordinates for d1bf9__.
(The format of our PDB-style files is described here.)

Timeline for d1bf9__: