Lineage for d1ff7a_ (1ff7 A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 39969Protein Coagulation factor VIIa [57201] (1 species)
  7. 39970Species Human (Homo sapiens) [TaxId:9606] [57202] (10 PDB entries)
  8. 39984Domain d1ff7a_: 1ff7 A: [44222]

Details for d1ff7a_

PDB Entry: 1ff7 (more details)

PDB Description: the first egf-like domain from human blood coagulation fvii (fucosylated at ser-60), nmr, 20 structures

SCOP Domain Sequences for d1ff7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ff7a_ g.3.11.1 (A:) Coagulation factor VIIa {Human (Homo sapiens)}
sdgdqcasspcqnggsckdqlqsyicfclpafegrncethkddgsa

SCOP Domain Coordinates for d1ff7a_:

Click to download the PDB-style file with coordinates for d1ff7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ff7a_: