Lineage for d1dvam2 (1dva M:87-142)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 39969Protein Coagulation factor VIIa [57201] (1 species)
  7. 39970Species Human (Homo sapiens) [TaxId:9606] [57202] (10 PDB entries)
  8. 39981Domain d1dvam2: 1dva M:87-142 [44219]
    Other proteins in same PDB: d1dvah_, d1dvai_

Details for d1dvam2

PDB Entry: 1dva (more details), 3 Å

PDB Description: crystal structure of the complex between the peptide exosite inhibitor e-76 and coagulation factor viia

SCOP Domain Sequences for d1dvam2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvam2 g.3.11.1 (M:87-142) Coagulation factor VIIa {Human (Homo sapiens)}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOP Domain Coordinates for d1dvam2:

Click to download the PDB-style file with coordinates for d1dvam2.
(The format of our PDB-style files is described here.)

Timeline for d1dvam2:

39981
d1dvam2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1dvam1