Lineage for d1dvam2 (1dva M:87-142)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031147Protein Coagulation factor VIIa [57201] (1 species)
  7. 3031148Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 3031271Domain d1dvam2: 1dva M:87-142 [44219]
    Other proteins in same PDB: d1dvah_, d1dvai_
    complexed with 0z6, ca, cac, fuc, ful, glc

Details for d1dvam2

PDB Entry: 1dva (more details), 3 Å

PDB Description: crystal structure of the complex between the peptide exosite inhibitor e-76 and coagulation factor viia
PDB Compounds: (M:) des-gla factor viia (light chain)

SCOPe Domain Sequences for d1dvam2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvam2 g.3.11.1 (M:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d1dvam2:

Click to download the PDB-style file with coordinates for d1dvam2.
(The format of our PDB-style files is described here.)

Timeline for d1dvam2: