Lineage for d1dval2 (1dva L:87-142)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062283Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1062284Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1062293Protein Coagulation factor VIIa [57201] (1 species)
  7. 1062294Species Human (Homo sapiens) [TaxId:9606] [57202] (17 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 1062312Domain d1dval2: 1dva L:87-142 [44217]
    Other proteins in same PDB: d1dvah_, d1dvai_
    complexed with 0z6, ca, cac, fuc, ful, glc

Details for d1dval2

PDB Entry: 1dva (more details), 3 Å

PDB Description: Crystal Structure of the Complex Between the Peptide Exosite Inhibitor E-76 and Coagulation Factor VIIA
PDB Compounds: (L:) des-gla factor viia (light chain)

SCOPe Domain Sequences for d1dval2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dval2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d1dval2:

Click to download the PDB-style file with coordinates for d1dval2.
(The format of our PDB-style files is described here.)

Timeline for d1dval2: