SCOP 1.55: Domain d1qfkl2: 1qfk L:87-144

Lineage for d1qfkl2 (1qfk L:87-144)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (4 families)

5. Family g.3.11.1: EGF-type module [57197] (16 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (10 PDB entries)

8. Domain d1qfkl2: 1qfk L:87-144 [44215]
   Other proteins in same PDB: d1qfkh_

Details for d1qfkl2

PDB Entry: 1qfk, 2.8 Å

PDB Description: structure of human factor viia and its implications for the triggering of blood coagulation

SCOP Domain Sequences for d1qfkl2:

Sequence; same for both SEQRES and ATOM records:

>d1qfkl2 g.3.11.1 (L:87-144) Coagulation factor VIIa {Human (Homo sapiens)}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

Timeline for d1qfkl2:

• d1qfkl2 appears in SCOP 1.57
  
• d1qfkl2 appears in the current release, SCOPe 2.08