Lineage for d1qfkl1 (1qfk L:49-86)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 39969Protein Coagulation factor VIIa [57201] (1 species)
  7. 39970Species Human (Homo sapiens) [TaxId:9606] [57202] (10 PDB entries)
  8. 39976Domain d1qfkl1: 1qfk L:49-86 [44214]
    Other proteins in same PDB: d1qfkh_

Details for d1qfkl1

PDB Entry: 1qfk (more details), 2.8 Å

PDB Description: structure of human factor viia and its implications for the triggering of blood coagulation

SCOP Domain Sequences for d1qfkl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfkl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens)}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOP Domain Coordinates for d1qfkl1:

Click to download the PDB-style file with coordinates for d1qfkl1.
(The format of our PDB-style files is described here.)

Timeline for d1qfkl1:

39976
d1qfkl1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1qfkl2
39976
d1qfkl1 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1qfkh_