Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Coagulation factor VIIa [57201] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
Domain d1fakl2: 1fak L:87-143 [44213] Other proteins in same PDB: d1fakh_, d1faki_, d1fakl3, d1fakt1, d1fakt2 complexed with ca, fuc, glc; mutant |
PDB Entry: 1fak (more details), 2.1 Å
SCOPe Domain Sequences for d1fakl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fakl2 g.3.11.1 (L:87-143) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek
Timeline for d1fakl2:
View in 3D Domains from other chains: (mouse over for more information) d1fakh_, d1faki_, d1fakt1, d1fakt2 |