Lineage for d1fakl2 (1fak L:87-143)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268805Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 269314Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 269315Family g.3.11.1: EGF-type module [57197] (18 proteins)
  6. 269324Protein Coagulation factor VIIa [57201] (1 species)
  7. 269325Species Human (Homo sapiens) [TaxId:9606] [57202] (13 PDB entries)
  8. 269332Domain d1fakl2: 1fak L:87-143 [44213]
    Other proteins in same PDB: d1fakh_, d1faki_, d1fakl3, d1fakt1, d1fakt2

Details for d1fakl2

PDB Entry: 1fak (more details), 2.1 Å

PDB Description: human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant
PDB Compounds: (L:)

SCOP Domain Sequences for d1fakl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fakl2 g.3.11.1 (L:87-143) Coagulation factor VIIa {Human (Homo sapiens)}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek

SCOP Domain Coordinates for d1fakl2:

Click to download the PDB-style file with coordinates for d1fakl2.
(The format of our PDB-style files is described here.)

Timeline for d1fakl2: