![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (22 proteins) |
![]() | Protein Coagulation factor VIIa [57201] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries) |
![]() | Domain d1cvwl_: 1cvw L: [44211] Other proteins in same PDB: d1cvwh_ complexed with ans, ca |
PDB Entry: 1cvw (more details), 2.28 Å
SCOP Domain Sequences for d1cvwl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cvwl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr
Timeline for d1cvwl_: