![]() | Class g: Small proteins [56992] (66 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies) disulphide-bound fold; contains beta-hairpin with two adjacent disulphides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (6 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (20 proteins) |
![]() | Protein Coagulation factor VIIa [57201] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57202] (13 PDB entries) |
![]() | Domain d1danl1: 1dan L:49-86 [44209] Other proteins in same PDB: d1dan.1, d1danh_, d1danl3, d1danu1 |
PDB Entry: 1dan (more details), 2 Å
SCOP Domain Sequences for d1danl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1danl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens)} qcasspcqnggsckdqlqsyicfclpafegrncethkd
Timeline for d1danl1:
![]() Domains from other chains: (mouse over for more information) d1dan.1, d1dan.1, d1danh_, d1danu1 |