![]() | Class g: Small proteins [56992] (72 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (6 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (21 proteins) |
![]() | Protein Factor IX (IXa) [57198] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [57200] (1 PDB entry) |
![]() | Domain d1pfxl2: 1pfx L:87-146 [44208] Other proteins in same PDB: d1pfxc_, d1pfxl3 complexed with doh |
PDB Entry: 1pfx (more details), 3 Å
SCOP Domain Sequences for d1pfxl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pfxl2 g.3.11.1 (L:87-146) Factor IX (IXa) {Pig (Sus scrofa)} tcnikngrckqfcktgadskvlcscttgyrlapdqksckpavpfpcgrvsvshspttltr
Timeline for d1pfxl2: