![]() | Class g: Small proteins [56992] (75 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (6 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (21 proteins) |
![]() | Protein Factor IX (IXa) [57198] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57199] (3 PDB entries) |
![]() | Domain d1rfnb_: 1rfn B: [44205] Other proteins in same PDB: d1rfna_ |
PDB Entry: 1rfn (more details), 2.8 Å
SCOP Domain Sequences for d1rfnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens)} mtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtsk
Timeline for d1rfnb_: