Lineage for d1ethd2 (1eth D:45-90)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39943Superfamily g.3.10: Colipase-like [57190] (1 family) (S)
  5. 39944Family g.3.10.1: Colipase-like [57191] (2 proteins)
  6. 39945Protein (Pro)colipase [57192] (1 species)
  7. 39946Species Pig (Sus scrofa) [TaxId:9823] [57193] (5 PDB entries)
  8. 39954Domain d1ethd2: 1eth D:45-90 [44196]
    Other proteins in same PDB: d1etha1, d1etha2, d1ethc1, d1ethc2

Details for d1ethd2

PDB Entry: 1eth (more details), 2.8 Å

PDB Description: triacylglycerol lipase/colipase complex

SCOP Domain Sequences for d1ethd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ethd2 g.3.10.1 (D:45-90) (Pro)colipase {Pig (Sus scrofa)}
ensecsaftlygvyykcpcergltcegdkslvgsitntnfgichnv

SCOP Domain Coordinates for d1ethd2:

Click to download the PDB-style file with coordinates for d1ethd2.
(The format of our PDB-style files is described here.)

Timeline for d1ethd2:

39954
d1ethd2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ethd1