SCOPe 2.08: Domain d1lpba2: 1lpb A:45-90

Lineage for d1lpba2 (1lpb A:45-90)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.10: Colipase-like [57190] (2 families)

5. Family g.3.10.1: Colipase-like [57191] (2 proteins)

6. Protein (Pro)colipase [57192] (1 species)
   duplication: consists of two (sub)domains of this common fold

7. Species Pig (Sus scrofa) [TaxId:9823] [57193] (6 PDB entries)

8. Domain d1lpba2: 1lpb A:45-90 [44190]
   Other proteins in same PDB: d1lpbb1, d1lpbb2
   complexed with bog, ca, mup

Details for d1lpba2

PDB Entry: 1lpb, 2.46 Å

PDB Description: the 2.46 angstroms resolution structure of the pancreatic lipase colipase complex inhibited by a c11 alkyl phosphonate

PDB Compounds: (A:) colipase

SCOPe Domain Sequences for d1lpba2:

Sequence; same for both SEQRES and ATOM records:

>d1lpba2 g.3.10.1 (A:45-90) (Pro)colipase {Pig (Sus scrofa) [TaxId: 9823]}
ensecsaftlygvyykcpcergltcegdkslvgsitntnfgichnv

Timeline for d1lpba2:

• d1lpba2 first appeared (with stable ids) in SCOP 1.55
  
• d1lpba2 appears in SCOPe 2.07