Lineage for d1lpba2 (1lpb A:45-90)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582576Superfamily g.3.10: Colipase-like [57190] (2 families) (S)
  5. 2582577Family g.3.10.1: Colipase-like [57191] (2 protein domains)
  6. 2582578Protein (Pro)colipase [57192] (1 species)
    duplication: consists of two (sub)domains of this common fold
  7. 2582579Species Pig (Sus scrofa) [TaxId:9823] [57193] (6 PDB entries)
  8. 2582585Domain d1lpba2: 1lpb A:45-90 [44190]
    Other proteins in same PDB: d1lpbb1, d1lpbb2
    complexed with bog, ca, mup

Details for d1lpba2

PDB Entry: 1lpb (more details), 2.46 Å

PDB Description: the 2.46 angstroms resolution structure of the pancreatic lipase colipase complex inhibited by a c11 alkyl phosphonate
PDB Compounds: (A:) colipase

SCOPe Domain Sequences for d1lpba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpba2 g.3.10.1 (A:45-90) (Pro)colipase {Pig (Sus scrofa) [TaxId: 9823]}
ensecsaftlygvyykcpcergltcegdkslvgsitntnfgichnv

SCOPe Domain Coordinates for d1lpba2:

Click to download the PDB-style file with coordinates for d1lpba2.
(The format of our PDB-style files is described here.)

Timeline for d1lpba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lpba1