![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) ![]() |
![]() | Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins) |
![]() | Protein Type 1 insulin-like growth factor receptor Cys-rich domain [57188] (1 species) contains 3 cystine-knot subdomains and 4 single-disulfide cystine knot-like subdomains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57189] (1 PDB entry) |
![]() | Domain d1igra3: 1igr A:150-299 [44188] Other proteins in same PDB: d1igra1, d1igra2 complexed with nag, so4 |
PDB Entry: 1igr (more details), 2.6 Å
SCOPe Domain Sequences for d1igra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igra3 g.3.9.1 (A:150-299) Type 1 insulin-like growth factor receptor Cys-rich domain {Human (Homo sapiens) [TaxId: 9606]} dlcpgtmeekpmcekttinneynyrcwttnrcqkmcpstcgkractennecchpeclgsc sapdndtacvacrhyyyagvcvpacppntyrfegwrcvdrdfcanilsaessdsegfvih dgecmqecpsgfirngsqsmycipcegpcp
Timeline for d1igra3: