Lineage for d1igra3 (1igr A:150-299)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459803Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 1459804Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins)
  6. 1459860Protein Type 1 insulin-like growth factor receptor Cys-rich domain [57188] (1 species)
    contains 3 cystine-knot subdomains and 4 single-disulfide cystine knot-like subdomains
  7. 1459861Species Human (Homo sapiens) [TaxId:9606] [57189] (1 PDB entry)
  8. 1459862Domain d1igra3: 1igr A:150-299 [44188]
    Other proteins in same PDB: d1igra1, d1igra2
    complexed with nag, so4

Details for d1igra3

PDB Entry: 1igr (more details), 2.6 Å

PDB Description: type 1 insulin-like growth factor receptor (domains 1-3)
PDB Compounds: (A:) insulin-like growth factor receptor 1

SCOPe Domain Sequences for d1igra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igra3 g.3.9.1 (A:150-299) Type 1 insulin-like growth factor receptor Cys-rich domain {Human (Homo sapiens) [TaxId: 9606]}
dlcpgtmeekpmcekttinneynyrcwttnrcqkmcpstcgkractennecchpeclgsc
sapdndtacvacrhyyyagvcvpacppntyrfegwrcvdrdfcanilsaessdsegfvih
dgecmqecpsgfirngsqsmycipcegpcp

SCOPe Domain Coordinates for d1igra3:

Click to download the PDB-style file with coordinates for d1igra3.
(The format of our PDB-style files is described here.)

Timeline for d1igra3: