Lineage for d1boea_ (1boe A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1240201Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1240879Superfamily g.3.9: Growth factor receptor domain [57184] (1 family) (S)
  5. 1240880Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins)
  6. 1240914Protein Insulin-like growth factor-binding protein-5 (IGFBP-5) [57186] (1 species)
  7. 1240915Species Human (Homo sapiens) [TaxId:9606] [57187] (2 PDB entries)
  8. 1240917Domain d1boea_: 1boe A: [44187]

Details for d1boea_

PDB Entry: 1boe (more details)

PDB Description: structure of the igf binding domain of the insulin-like growth factor- binding protein-5 (igfbp-5): implications for igf and igf-i receptor interactions
PDB Compounds: (A:) protein (insulin-like growth factor-binding protein-5 (igfbp-5))

SCOPe Domain Sequences for d1boea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1boea_ g.3.9.1 (A:) Insulin-like growth factor-binding protein-5 (IGFBP-5) {Human (Homo sapiens) [TaxId: 9606]}
alaegqscgvytercaqglrclprqdeekplhallhgrgvclneks

SCOPe Domain Coordinates for d1boea_:

Click to download the PDB-style file with coordinates for d1boea_.
(The format of our PDB-style files is described here.)

Timeline for d1boea_: