Lineage for d1boea_ (1boe A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39935Superfamily g.3.9: IGF binding domain [57184] (1 family) (S)
  5. 39936Family g.3.9.1: IGF binding domain [57185] (2 proteins)
  6. 39940Protein Insulin-like growth factor-binding protein-5 (IGFBP-5) [57186] (1 species)
  7. 39941Species Human (Homo sapiens) [TaxId:9606] [57187] (1 PDB entry)
  8. 39942Domain d1boea_: 1boe A: [44187]

Details for d1boea_

PDB Entry: 1boe (more details)

PDB Description: structure of the igf binding domain of the insulin-like growth factor-binding protein-5 (igfbp-5): implications for igf and igf-i receptor interactions

SCOP Domain Sequences for d1boea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1boea_ g.3.9.1 (A:) Insulin-like growth factor-binding protein-5 (IGFBP-5) {Human (Homo sapiens)}
alaegqscgvytercaqglrclprqdeekplhallhgrgvclneks

SCOP Domain Coordinates for d1boea_:

Click to download the PDB-style file with coordinates for d1boea_.
(The format of our PDB-style files is described here.)

Timeline for d1boea_: