Lineage for d1bk8a_ (1bk8 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635563Family g.3.7.5: Plant defensins [57170] (9 proteins)
  6. 2635567Protein Antimicrobial protein 1 (AH-AMP1) [57176] (1 species)
  7. 2635568Species Horse chestnut (Aesculus hippocastanum) [TaxId:43364] [57177] (1 PDB entry)
  8. 2635569Domain d1bk8a_: 1bk8 A: [44178]

Details for d1bk8a_

PDB Entry: 1bk8 (more details)

PDB Description: determination of the three-dimensional solution structure of aesculus hippocastanum antimicrobial protein 1 (ah-amp1) by 1h nmr, 25 structures
PDB Compounds: (A:) antimicrobial protein 1

SCOPe Domain Sequences for d1bk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bk8a_ g.3.7.5 (A:) Antimicrobial protein 1 (AH-AMP1) {Horse chestnut (Aesculus hippocastanum) [TaxId: 43364]}
lcnerpsqtwsgncgntahcdkqcqdwekashgachkrenhwkcfcyfnc

SCOPe Domain Coordinates for d1bk8a_:

Click to download the PDB-style file with coordinates for d1bk8a_.
(The format of our PDB-style files is described here.)

Timeline for d1bk8a_: