SCOP 1.65: Domain d1ayj__: 1ayj -

Lineage for d1ayj__ (1ayj -)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
   disulphide-bound fold; contains beta-hairpin with two adjacent disulphides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (5 families)

5. Family g.3.7.5: Plant defensins [57170] (6 proteins)

6. Protein Antifungal protein 1 (RS-AFP1) [57174] (1 species)

7. Species Radish (Raphanus sativus) [TaxId:3726] [57175] (1 PDB entry)

8. Domain d1ayj__: 1ayj - [44177]

Details for d1ayj__

PDB Entry: 1ayj

PDB Description: determination of the three-dimensional solution structure of raphanus sativus antifungal protein 1 (rs-afp1) by 1h nmr, 20 structures

SCOP Domain Sequences for d1ayj__:

Sequence; same for both SEQRES and ATOM records:

>d1ayj__ g.3.7.5 (-) Antifungal protein 1 (RS-AFP1) {Radish (Raphanus sativus)}
eklcerpsgtwsgvcgnnnacknqcinlekarhgscnyvfpahkcicyfpc

Timeline for d1ayj__:

• d1ayj__ first appeared (with stable ids) in SCOP 1.55
  
• d1ayj__ appears in SCOP 1.63
  
• d1ayj__ appears in SCOP 1.67
  
• d1ayj__ appears in the current release, SCOPe 2.08, called d1ayja_