Lineage for d1myn__ (1myn -)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621450Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 621806Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 621997Family g.3.7.4: Insect defensins [57163] (5 proteins)
  6. 622011Protein Drosomycin [57164] (1 species)
    inducible antifungal protein
  7. 622012Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57165] (1 PDB entry)
  8. 622013Domain d1myn__: 1myn - [44172]

Details for d1myn__

PDB Entry: 1myn (more details)

PDB Description: solution structure of drosomycin, the first inducible antifungal protein from insects, nmr, 15 structures

SCOP Domain Sequences for d1myn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1myn__ g.3.7.4 (-) Drosomycin {Fruit fly (Drosophila melanogaster)}
dclsgrykgpcavwdnetcrrvckeegrssghcspslkcwcegc

SCOP Domain Coordinates for d1myn__:

Click to download the PDB-style file with coordinates for d1myn__.
(The format of our PDB-style files is described here.)

Timeline for d1myn__: