Lineage for d1fjna_ (1fjn A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889275Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 889473Family g.3.7.3: Defensin MGD-1 [57160] (1 protein)
  6. 889474Protein Defensin MGD-1 [57161] (1 species)
  7. 889475Species Mediterranean mussel (Mytilus galloprovincialis) [TaxId:29158] [57162] (1 PDB entry)
  8. 889476Domain d1fjna_: 1fjn A: [44171]

Details for d1fjna_

PDB Entry: 1fjn (more details)

PDB Description: solution structure and activity of the four disulfide bond mediterranean mussel defensin mgd-1
PDB Compounds: (A:) defensin mgd-1

SCOP Domain Sequences for d1fjna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjna_ g.3.7.3 (A:) Defensin MGD-1 {Mediterranean mussel (Mytilus galloprovincialis) [TaxId: 29158]}
gfgcpnnyqchrhcksipgrcggycggwhrlrctcyrcg

SCOP Domain Coordinates for d1fjna_:

Click to download the PDB-style file with coordinates for d1fjna_.
(The format of our PDB-style files is described here.)

Timeline for d1fjna_: