Lineage for d1sco__ (1sco -)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) 
Family g.3.7.2: Short-chain scorpion toxins [57116] (22 proteins) Protein OSK1 TOXIN [57149] (1 species) Species Central asian scorpion (Orthochirus scrobiculosus) [TaxId:6892] [57150] (1 PDB entry) 
Domain d1sco__: 1sco - [44164]
Details for d1sco__
PDB Entry: 1sco (more details)
PDB Description: scorpion toxin (osk1 toxin) with high affinity for small conductance ca(2+)-activated k+ channel in neuroblastoma-x-gluoma ng 108-15 hybrid cells, nmr, 30 structures
SCOP Domain Sequences for d1sco__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sco__ g.3.7.2 (-) OSK1 TOXIN {Central asian scorpion (Orthochirus scrobiculosus)}
gviinvkckisrqclepckkagmrfgkcmngkchctpk
SCOP Domain Coordinates for d1sco__:
Click to download the PDB-style file with coordinates for d1sco__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sco__:
- d1sco__ first appeared (with stable ids) in SCOP 1.55
- d1sco__ appears in SCOP 1.59
- d1sco__ appears in the current release, SCOPe 2.08, called d1scoa_
View in 3D