Lineage for d1chla_ (1chl A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030578Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 3030621Protein Chlorootoxin [57137] (2 species)
  7. 3030624Species Scorpion (Leiurus quinquestriatus), venom [TaxId:6883] [57138] (1 PDB entry)
  8. 3030625Domain d1chla_: 1chl A: [44157]

Details for d1chla_

PDB Entry: 1chl (more details)

PDB Description: nmr sequential assignments and solution structure of chlorotoxin, a small scorpion toxin that blocks chloride channels
PDB Compounds: (A:) chlorotoxin

SCOPe Domain Sequences for d1chla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chla_ g.3.7.2 (A:) Chlorootoxin {Scorpion (Leiurus quinquestriatus), venom [TaxId: 6883]}
mcmpcfttdhqmarkcddccggkgrgkcygpqclcr

SCOPe Domain Coordinates for d1chla_:

Click to download the PDB-style file with coordinates for d1chla_.
(The format of our PDB-style files is described here.)

Timeline for d1chla_: