Lineage for d1agta_ (1agt A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030578Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 3030579Protein Agitoxin [57135] (1 species)
  7. 3030580Species Scorpion (Leiurus quinquestriatus hebraeus) [TaxId:6884] [57136] (1 PDB entry)
  8. 3030581Domain d1agta_: 1agt A: [44156]

Details for d1agta_

PDB Entry: 1agt (more details)

PDB Description: solution structure of the potassium channel inhibitor agitoxin 2: caliper for probing channel geometry
PDB Compounds: (A:) agitoxin 2

SCOPe Domain Sequences for d1agta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agta_ g.3.7.2 (A:) Agitoxin {Scorpion (Leiurus quinquestriatus hebraeus) [TaxId: 6884]}
gvpinvsctgspqcikpckdagmrfgkcmnrkchctpk

SCOPe Domain Coordinates for d1agta_:

Click to download the PDB-style file with coordinates for d1agta_.
(The format of our PDB-style files is described here.)

Timeline for d1agta_: