Lineage for d1txma_ (1txm A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. Protein Maurotoxin [57129] (2 species)
  7. Species Scorpion (Scorpio maurus) [TaxId:53956] [57130] (3 PDB entries)
    Uniprot P80719
  8. Domain d1txma_: 1txm A: [44151]

Details for d1txma_

PDB Entry: 1txm (more details)

PDB Description: scorpion toxin (maurotoxin) from scorpio maurus, nmr, 35 structures
PDB Compounds: (A:) maurotoxin

SCOPe Domain Sequences for d1txma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txma_ g.3.7.2 (A:) Maurotoxin {Scorpion (Scorpio maurus) [TaxId: 53956]}
vsctgskdcyapcrkqtgcpnakcinksckcygc

SCOPe Domain Coordinates for d1txma_ are not available.

Timeline for d1txma_: