Lineage for d1biga_ (1big A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. Protein Bmtx1 [57117] (1 species)
  7. Species Chinese scorpion (Buthus martensii) [TaxId:34649] [57118] (1 PDB entry)
  8. Domain d1biga_: 1big A: [44145]

Details for d1biga_

PDB Entry: 1big (more details)

PDB Description: scorpion toxin bmtx1 from buthus martensii karsch, nmr, 25 structures
PDB Compounds: (A:) toxin bmtx1

SCOPe Domain Sequences for d1biga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1biga_ g.3.7.2 (A:) Bmtx1 {Chinese scorpion (Buthus martensii) [TaxId: 34649]}
eftdvkctgskqcwpvckqmfgkpngkcmngkcrcys

SCOPe Domain Coordinates for d1biga_ are not available.

Timeline for d1biga_: