Lineage for d1dq7b_ (1dq7 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030457Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 3030473Protein Scorpion toxin [57097] (17 species)
  7. 3030513Species Indian red scorpion (Buthus tamulus), neurotoxin [TaxId:34647] [57109] (2 PDB entries)
  8. 3030515Domain d1dq7b_: 1dq7 B: [44138]

Details for d1dq7b_

PDB Entry: 1dq7 (more details), 2.2 Å

PDB Description: three-dimensional structure of a neurotoxin from red scorpion (buthus tamulus) at 2.2a resolution.
PDB Compounds: (B:) Neurotoxin

SCOPe Domain Sequences for d1dq7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq7b_ g.3.7.1 (B:) Scorpion toxin {Indian red scorpion (Buthus tamulus), neurotoxin [TaxId: 34647]}
gedgyiadgdnctyictfnnychalctdkkgdsgacdwwvpygvvcwcedlptpvpirgs
gkcr

SCOPe Domain Coordinates for d1dq7b_:

Click to download the PDB-style file with coordinates for d1dq7b_.
(The format of our PDB-style files is described here.)

Timeline for d1dq7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dq7a_