Lineage for d1dq7b_ (1dq7 B:)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfidesSuperfamily g.3.7: Scorpion toxin-like [57095] (6 families) 
Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) Protein Scorpion toxin [57097] (17 species) 
Species Indian red scorpion (Buthus tamulus), neurotoxin [TaxId:34647] [57109] (2 PDB entries) 
Domain d1dq7b_: 1dq7 B: [44138]
Details for d1dq7b_
PDB Entry: 1dq7 (more details), 2.2 Å
PDB Description: three-dimensional structure of a neurotoxin from red scorpion (buthus tamulus) at 2.2a resolution.
PDB Compounds: (B:) NeurotoxinSCOPe Domain Sequences for d1dq7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dq7b_ g.3.7.1 (B:) Scorpion toxin {Indian red scorpion (Buthus tamulus), neurotoxin [TaxId: 34647]}
gedgyiadgdnctyictfnnychalctdkkgdsgacdwwvpygvvcwcedlptpvpirgs
gkcr
SCOPe Domain Coordinates for d1dq7b_:
Click to download the PDB-style file with coordinates for d1dq7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dq7b_:
- d1dq7b_ first appeared (with stable ids) in SCOP 1.55
- d1dq7b_ appears in SCOPe 2.07
View in 3D
