Lineage for d1dq7a_ (1dq7 A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39779Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 39780Family g.3.7.1: Long-chain scorpion toxins [57096] (3 proteins)
  6. 39791Protein Scorpion toxin [57097] (13 species)
  7. 39811Species Indian red scorpion (Buthus tamulus), neurotoxin [TaxId:34647] [57109] (1 PDB entry)
  8. 39812Domain d1dq7a_: 1dq7 A: [44137]

Details for d1dq7a_

PDB Entry: 1dq7 (more details), 2.2 Å

PDB Description: three-dimensional structure of a neurotoxin from red scorpion (buthus tamulus) at 2.2a resolution.

SCOP Domain Sequences for d1dq7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq7a_ g.3.7.1 (A:) Scorpion toxin {Indian red scorpion (Buthus tamulus), neurotoxin}
gedgyiadgdnctyictfnnychalctdkkgdsgacdwwvpygvvcwcedlptpvpirgs
gkcr

SCOP Domain Coordinates for d1dq7a_:

Click to download the PDB-style file with coordinates for d1dq7a_.
(The format of our PDB-style files is described here.)

Timeline for d1dq7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dq7b_