Lineage for d1ptxa_ (1ptx A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1700854Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 1700855Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 1700871Protein Scorpion toxin [57097] (17 species)
  7. 1700925Species Scorpion (Androctonus australis hector), Toxin II [TaxId:70175] [57102] (4 PDB entries)
    Uniprot P01484
  8. 1700927Domain d1ptxa_: 1ptx A: [44128]

Details for d1ptxa_

PDB Entry: 1ptx (more details), 1.3 Å

PDB Description: crystal structure of toxin ii from the scorpion androctonus australis hector refined at 1.3 angstroms resolution
PDB Compounds: (A:) scorpion toxin II

SCOPe Domain Sequences for d1ptxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ptxa_ g.3.7.1 (A:) Scorpion toxin {Scorpion (Androctonus australis hector), Toxin II [TaxId: 70175]}
vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp
grch

SCOPe Domain Coordinates for d1ptxa_:

Click to download the PDB-style file with coordinates for d1ptxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ptxa_: