Lineage for d1agga_ (1agg A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2581864Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 2581905Family g.3.6.2: Spider toxins [57072] (26 proteins)
  6. 2581971Protein omega-Agatoxin IV, IVa, IVb [57073] (1 species)
  7. 2581972Species Funnel web spider (Agelenopsis aperta) [TaxId:6908] [57074] (6 PDB entries)
  8. 2581973Domain d1agga_: 1agg A: [44102]

Details for d1agga_

PDB Entry: 1agg (more details)

PDB Description: the solution structure of omega-aga-ivb, a p-type calcium channel antagonist from the venom of agelenopsis aperta
PDB Compounds: (A:) omega-agatoxin-ivb

SCOPe Domain Sequences for d1agga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agga_ g.3.6.2 (A:) omega-Agatoxin IV, IVa, IVb {Funnel web spider (Agelenopsis aperta) [TaxId: 6908]}
ednciaedygkctwggtkccrgrpcrcsmigtncectprlimeglsfa

SCOPe Domain Coordinates for d1agga_:

Click to download the PDB-style file with coordinates for d1agga_.
(The format of our PDB-style files is described here.)

Timeline for d1agga_: