Lineage for d1ag7__ (1ag7 -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39707Superfamily g.3.6: omega toxin-like [57059] (2 families) (S)
  5. 39708Family g.3.6.1: Conotoxin [57060] (1 protein)
  6. 39709Protein Conotoxin [57061] (10 species)
  7. 39736Species Synthetic, based on Conus geographus, GS [57063] (1 PDB entry)
  8. 39737Domain d1ag7__: 1ag7 - [44086]

Details for d1ag7__

PDB Entry: 1ag7 (more details)

PDB Description: conotoxin gs, nmr, 20 structures

SCOP Domain Sequences for d1ag7__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ag7__ g.3.6.1 (-) Conotoxin {Synthetic, based on Conus geographus, GS}
acsgrgsrcppqccmglrcgrgnpqkcigahedv

SCOP Domain Coordinates for d1ag7__:

Click to download the PDB-style file with coordinates for d1ag7__.
(The format of our PDB-style files is described here.)

Timeline for d1ag7__: