Lineage for d1ag7a_ (1ag7 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030282Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 3030283Family g.3.6.1: Conotoxin [57060] (1 protein)
  6. 3030284Protein Conotoxin [57061] (13 species)
  7. 3030321Species Synthetic, based on Conus geographus, GS [57063] (1 PDB entry)
  8. 3030322Domain d1ag7a_: 1ag7 A: [44086]

Details for d1ag7a_

PDB Entry: 1ag7 (more details)

PDB Description: conotoxin gs, nmr, 20 structures
PDB Compounds: (A:) conotoxin gs

SCOPe Domain Sequences for d1ag7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ag7a_ g.3.6.1 (A:) Conotoxin {Synthetic, based on Conus geographus, GS}
acsgrgsrcppqccmglrcgrgnpqkcigahedv

SCOPe Domain Coordinates for d1ag7a_:

Click to download the PDB-style file with coordinates for d1ag7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ag7a_: