Lineage for d1dkca_ (1dkc A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030262Superfamily g.3.4: Gurmarin-like [57048] (2 families) (S)
  5. 3030269Family g.3.4.2: Antifungal peptide [57052] (2 proteins)
    automatically mapped to Pfam PF11410
  6. 3030273Protein Antifungal peptide PAFP-S [57053] (1 species)
  7. 3030274Species Pokeweed (Phytolacca americana) [TaxId:3527] [57054] (1 PDB entry)
  8. 3030275Domain d1dkca_: 1dkc A: [44082]

Details for d1dkca_

PDB Entry: 1dkc (more details)

PDB Description: solution structure of pafp-s, an antifungal peptide from the seeds of phytolacca americana
PDB Compounds: (A:) antifungal peptide

SCOPe Domain Sequences for d1dkca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkca_ g.3.4.2 (A:) Antifungal peptide PAFP-S {Pokeweed (Phytolacca americana) [TaxId: 3527]}
agciknggrcnasagppyccssycfqiagqsygvcknr

SCOPe Domain Coordinates for d1dkca_:

Click to download the PDB-style file with coordinates for d1dkca_.
(The format of our PDB-style files is described here.)

Timeline for d1dkca_: