Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1dkca_ (1dkc A:)

  1. Root: SCOP 1.75B
  2. Class g: Small proteins [56992] (90 folds)
  3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. Superfamily g.3.4: Gurmarin-like [57048] (2 families) (S)
  5. Family g.3.4.2: Antifungal peptide [57052] (2 protein domains)
  6. Protein Antifungal peptide PAFP-S [57053] (1 species)
  7. Species Pokeweed (Phytolacca americana) [TaxId:3527] [57054] (1 PDB entry)
  8. Domain d1dkca_: 1dkc A: [44082]

Details for d1dkca_

PDB Entry: 1dkc (more details)
PDB Description: solution structure of pafp-s, an antifungal peptide from the seeds of phytolacca americana
PDB Compounds: (A:) antifungal peptide

SCOP Domain Sequences for d1dkca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkca_ g.3.4.2 (A:) Antifungal peptide PAFP-S {Pokeweed (Phytolacca americana) [TaxId: 3527]}
agciknggrcnasagppyccssycfqiagqsygvcknr

SCOP Domain Coordinates for d1dkca_:

Click to download the PDB-style file with coordinates for d1dkca_.
(The format of our PDB-style files is described here.)

Timeline for d1dkca_:

d1dkca_ appears in SCOP 1.75A


d1dkca_
(click for larger image)

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu