![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family) ![]() |
![]() | Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (4 proteins) |
![]() | Protein alpha-amylase inhibitor (AAI) [57036] (1 species) |
![]() | Species Prince's feather (Amaranthus hypochondriacus) [TaxId:28502] [57037] (3 PDB entries) |
![]() | Domain d1clvi_: 1clv I: [44075] Other proteins in same PDB: d1clva1, d1clva2 complexed with ca, cl |
PDB Entry: 1clv (more details), 2 Å
SCOPe Domain Sequences for d1clvi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clvi_ g.3.2.1 (I:) alpha-amylase inhibitor (AAI) {Prince's feather (Amaranthus hypochondriacus) [TaxId: 28502]} cipkwnrcgpkmdgvpccepytctsdyygncs
Timeline for d1clvi_: