Lineage for d1clvi_ (1clv I:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 341673Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family) (S)
  5. 341674Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (3 proteins)
  6. 341675Protein alpha-amylase inhibitor (AAI) [57036] (1 species)
  7. 341676Species Prince's feather (Amaranthus hypochondriacus) [TaxId:28502] [57037] (3 PDB entries)
  8. 341677Domain d1clvi_: 1clv I: [44075]
    Other proteins in same PDB: d1clva1, d1clva2
    complexed with ca, cl

Details for d1clvi_

PDB Entry: 1clv (more details), 2 Å

PDB Description: yellow meal worm alpha-amylase in complex with the amaranth alpha- amylase inhibitor

SCOP Domain Sequences for d1clvi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clvi_ g.3.2.1 (I:) alpha-amylase inhibitor (AAI) {Prince's feather (Amaranthus hypochondriacus)}
cipkwnrcgpkmdgvpccepytctsdyygncs

SCOP Domain Coordinates for d1clvi_:

Click to download the PDB-style file with coordinates for d1clvi_.
(The format of our PDB-style files is described here.)

Timeline for d1clvi_: