Lineage for d1mmc__ (1mmc -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88441Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 88510Family g.3.1.2: Antimicrobial peptide 2, AC-AMP2 [57024] (1 protein)
  6. 88511Protein Antimicrobial peptide 2, AC-AMP2 [57025] (1 species)
  7. 88512Species Tassel (Amaranthus caudatus) [TaxId:3567] [57026] (1 PDB entry)
  8. 88513Domain d1mmc__: 1mmc - [44061]

Details for d1mmc__

PDB Entry: 1mmc (more details)

PDB Description: 1h nmr study of the solution structure of ac-amp2

SCOP Domain Sequences for d1mmc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmc__ g.3.1.2 (-) Antimicrobial peptide 2, AC-AMP2 {Tassel (Amaranthus caudatus)}
vgecvrgrcpsgmccsqfgycgkgpkycgr

SCOP Domain Coordinates for d1mmc__:

Click to download the PDB-style file with coordinates for d1mmc__.
(The format of our PDB-style files is described here.)

Timeline for d1mmc__: