Lineage for d1enma2 (1enm A:46-86)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies) 
Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) 
Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (3 proteins) Protein Isolectin VI [57020] (1 species) Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (5 PDB entries) 
Domain d1enma2: 1enm A:46-86 [44059]
Details for d1enma2
PDB Entry: 1enm (more details), 1.9 Å
PDB Description: uda trisaccharide complex. crystal structure of urtica dioica agglutinin, a superantigen presented by mhc molecules of class i and class ii
SCOP Domain Sequences for d1enma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1enma2 g.3.1.1 (A:46-86) Isolectin VI {Stinging nettle (Urtica dioica), UDA}
dhrcgaavgnppcgqdrccsvhgwcgggndycsgskcqyrc
SCOP Domain Coordinates for d1enma2:
Click to download the PDB-style file with coordinates for d1enma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1enma2:
- d1enma2 appears in SCOP 1.57
- d1enma2 appears in the current release, SCOPe 2.08
View in 3D
