Lineage for d1enma2 (1enm A:46-86)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2581532Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 2581533Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 2581544Protein Isolectin VI [57020] (1 species)
    consists of two homologous domains
  7. 2581545Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries)
  8. 2581553Domain d1enma2: 1enm A:46-86 [44059]

Details for d1enma2

PDB Entry: 1enm (more details), 1.9 Å

PDB Description: uda trisaccharide complex. crystal structure of urtica dioica agglutinin, a superantigen presented by mhc molecules of class i and class ii
PDB Compounds: (A:) agglutinin isolectin I/agglutinin isolectin v/ agglutinin isolectin vi

SCOPe Domain Sequences for d1enma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enma2 g.3.1.1 (A:46-86) Isolectin VI {Stinging nettle (Urtica dioica), UDA [TaxId: 3501]}
dhrcgaavgnppcgqdrccsvhgwcgggndycsggncqyrc

SCOPe Domain Coordinates for d1enma2:

Click to download the PDB-style file with coordinates for d1enma2.
(The format of our PDB-style files is described here.)

Timeline for d1enma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1enma1