Lineage for d1ehhb2 (1ehh B:46-89)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2634701Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 2634702Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 2634713Protein Isolectin VI [57020] (1 species)
    consists of two homologous domains
  7. 2634714Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries)
  8. 2634726Domain d1ehhb2: 1ehh B:46-89 [44057]
    complexed with nag

Details for d1ehhb2

PDB Entry: 1ehh (more details), 1.9 Å

PDB Description: crystal structure of urtica dioica agglutinin isolectin vi complex with tri-n-acetylchitotriose
PDB Compounds: (B:) agglutinin isolectin vi

SCOPe Domain Sequences for d1ehhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehhb2 g.3.1.1 (B:46-89) Isolectin VI {Stinging nettle (Urtica dioica), UDA [TaxId: 3501]}
dhrcgaavgnppcgqdrccsvhgwcgggndycsggkcqyrcsss

SCOPe Domain Coordinates for d1ehhb2:

Click to download the PDB-style file with coordinates for d1ehhb2.
(The format of our PDB-style files is described here.)

Timeline for d1ehhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehhb1