Lineage for d1ehhb2 (1ehh B:46-89)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 341572Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 341573Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (3 proteins)
  6. 341577Protein Isolectin VI [57020] (1 species)
    consists of two homologous domains
  7. 341578Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries)
  8. 341588Domain d1ehhb2: 1ehh B:46-89 [44057]
    complexed with nag

Details for d1ehhb2

PDB Entry: 1ehh (more details), 1.9 Å

PDB Description: crystal structure of urtica dioica agglutinin isolectin vi complex with tri-n-acetylchitotriose

SCOP Domain Sequences for d1ehhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehhb2 g.3.1.1 (B:46-89) Isolectin VI {Stinging nettle (Urtica dioica), UDA}
dhrcgaavgnppcgqdrccsvhgwcgggndycsggkcqyrcsss

SCOP Domain Coordinates for d1ehhb2:

Click to download the PDB-style file with coordinates for d1ehhb2.
(The format of our PDB-style files is described here.)

Timeline for d1ehhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehhb1