Class g: Small proteins [56992] (66 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies) disulphide-bound fold; contains beta-hairpin with two adjacent disulphides |
Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) |
Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (3 proteins) |
Protein Isolectin VI [57020] (1 species) consists of two homologous domains |
Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries) |
Domain d1ehhb2: 1ehh B:46-89 [44057] complexed with nag |
PDB Entry: 1ehh (more details), 1.9 Å
SCOP Domain Sequences for d1ehhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehhb2 g.3.1.1 (B:46-89) Isolectin VI {Stinging nettle (Urtica dioica), UDA} dhrcgaavgnppcgqdrccsvhgwcgggndycsggkcqyrcsss
Timeline for d1ehhb2: